PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g18430.1.p
Common NameBRADI_5g18430, LOC100833240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 338aa    MW: 38305.6 Da    PI: 8.2092
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g18430.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.78.3e-27196245352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++i+l d+++yF+lpi++A+k+L++++++LKr+CRqyGI+RWPhRkiksl
  Bradi5g18430.1.p 196 ASITLVDIAQYFHLPIREASKTLKIGVSILKRKCRQYGIPRWPHRKIKSL 245
                       689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.725180265IPR003035RWP-RK domain
PfamPF020425.6E-22197245IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MDAVVSTLSA LAVFVNTTDH GAVRSVHGYR VVAKGGDCGW EKWVEREFAF SPSSCRELPA  60
PVVAPRLLSA DWVGRPVYHE GKMVGAWRCI LAFDSVAAVV PPPTPPPMLS PSGNPGLMSV  120
PSLYEDLNEV FQFQNSEKVP ELQCDPDEQS TRLDERERTS NEIGESDSDS DDDPQTGEGL  180
PEPVQKQRRA NQKYIASITL VDIAQYFHLP IREASKTLKI GVSILKRKCR QYGIPRWPHR  240
KIKSLDSLIH DLEYVIDDTE RDGVQREKAK HKKKEREMEK EKEKHDAIRA LAKRKKMLES  300
EKETITLKPA LDLMAETKQF REDVFKRRYR AKNIATR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581531.10.0PREDICTED: protein RKD5
TrEMBLA0A0Q3IDA00.0A0A0Q3IDA0_BRADI; Uncharacterized protein
STRINGBRADI5G18430.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-42RWP-RK domain-containing protein